Submit your work, meet writers and drop the ads. Become a member
Unknown Jul 2018
its 4:30 am...
im awake thinking, living, and breathing...
but somethings different..

my heart... its breaking,aching and shaking...
all because of a guy..

my minds racing, chasing, and raising..
all the problems of my life..

and im slowly fading, wasting, and breaking..
because i dont know who i am..

not anymore...



© Copyright Tyler Atherton
Ben Dec 2012
i'm in a dangerous state of mind
with no care for living this life
where human emotions are traded
for less than a pack of rubbers
but you didn't even use those
so how much did i truly mean
when the push came to shove
and grinding hips
with moaning lips
that whispered, screamed,
and cried his name
on the night you ****** my heart away
where loyalty takes a literal backseat
to pleasure
and a long term relationship
is laughing stock material
ha ha standup, ain't i funny
to look for something more than this
but i would choke on my own tongue
before i'd speak bad of you
my backstabbing lover
unfaithful friend
i hope to god it he was worth it
the cost was more than just tears
but blood spray on the bathroom mirror
and an empty place where i once
used to love
permanently empty
i can't find the will to care
more than a few half-hearted,
correct that, heartless
obscenities muttered under my breath
with ****** on my mind
a 3:30am fantasy to help dull
the pain that i should be feeling
maybe i'm just a pessimist,
fatalist, cynical, and negative
but my lack of surprise cuts the most
lied to by my mind for those
two months of my life
that i thought i had it all
better to have loved and lost
but even better to **** it all
and just go out with your name on my lips
and your lies in my heart
i hope you think of me when you're with him
that you choke on your tears
plagued with the worst emotions and loss
a better killer than any gun
i gave you everything and you gave it away
i can't sleep at night because when i close my eyes
all i see is you with him
Ranita Mar 2013
9:00pm: We hugged and chatted. Your sister joking with us, your brothers being silly. I love your siblings.

9:30pm: We went hunting for gear. Your dad helped us find sleeping mats and told us where to find some tarps.

10:00pm: We climbed onto the fort and made our beds. I swept the bugs and pine needles away. I remember thinking, I hate pine needles. Why Florida trees, why?

10:30pm: We made tea and got ready for bed. I love chamomile tea. Lots of sugar. Washing off my makeup was easy with your sister's fancy face wipes.

10:45pm: We climbed into our sleeping bags. I was warm. I love the plaid pattern of the sleeping bag I always use.

11:00pm: We ate snacks, drank tea, and talked. Poptarts are so good late at night. Better than in the morning. And the hot tea felt so good against the chilling breezes.

11:30pm: I turned off the flashlights. I liked it better that way. I like hearing only voices, not seeing the person. My hearing what they say feels amplified that way.

11:30pm: I laid on my back and realized how pretty the trees are. The sky was orange, oddly lit up more than normal for that time of night. Few clouds drifted in the sky.

12:00am: I poured the story out to you.

12:05am: I began watching the moon cross the sky. It was very orange and it moved faster than I imagined it would.

12:30am: I got a text.

1:00am: I proposed an adventure. I wanted to do something. I wanted not to have to think for a while. I like late night happenings. And I like not being alone.

1:15am: We got off our lazy butts and went to the garage. I started riding the ripstick. I picked it up right away and didn't fall which was new for me.

1:30am: You taught me how to longboard. It was fun, though I kept forgetting which way I would put my feet.

1:45am: We started riding bikes. I love your mom's bike. It's so smooth and easy to ride..but it clicks sometimes in weird ways. I liked the clicking too.

1:50am: ***** it, I didn't want to reply.

2:00am: We rode through the neighborhood. I love the houses in Naples..

2:05am: I fell in love with the night sky. It was beginning to look more like the normal dark blue rather than orange. The stars started to peek through better.

2:10am: The cold air made my blood rush. I was wearing such warm clothes, but the wind went straight through. I loved going fast, racing you. Speed is beautiful on a bike.

2:15am: I never wanted the night to end. I wanted to ride late at night forever.

2:35am: The silence was so beautiful. We would be quiet for short bits. I liked the pictures my mind created during that time.

2:40am: I wished I had his time stopping watch. I always wish I did.

2:45am: We started the ride home. My breathing got pretty rough. Cold air always hurts my lungs. But it was so worth it.

3:00am: We put the bikes away and crawled back into bed. I loved the fort so much..

3:10am: You fell asleep.

3:15am: The moon was higher in the sky. It was clear and white and full.  I could see it perfectly. Peeking through the trees. I fell asleep slowly. Loved it all.
Sleepover at a friend's house. That night was lovely. The next day was beautiful as well.
Florida weather has its perks.
Nat Lipstadt Jul 16
Stumbling into ancient scripts, authored a decades plus ago,
ago being a modifier of time quantities, minute or large, unspecific
without an objective adjective additive, that faucets a stream of an interlocutory elocution of a batter of rooted emotional histories,
but not histrionics

fanciful words for dredged up memories, acute, but tarnished,
powered yet worn by a cousin of ago, a/k/a,
age
and yet
renews as of,

at this very second, as if it were a first, a tumult of visions, swelling of remembrances, embodied scars, and I weep anew but not
for me, as much for the resonating simpatico souls with whom
they even  now vibrate with resonance of the immediacy of
If not now, When?

Aside: The exterior environment is noisy wet pelting of thunderstorms and ****** sheets of bulleting rain, piercing projectiles, but I am safe in the sunroom, sadly happy my dog is no longer here to shiver and tremble, cuddle and be soothed by steady stroking

But I am here, wrestling with this dredging operation, digging up
tons of sand that require dumping, and I ask, inquire, beg:

Who will take this detritus off my hands, once more, now uncovered,
now recovered, the soil is already soaked and can absorb no more,
the soul is already soaked and can absorb no more, the weakened
heart, damaged and occluded, suffer cannot bare twice the

outrageous misfortune

of unbared recollections, twice, or thrice, and I feel myself drowning in revisiting pain, **** **** ****, these old poems, not nuggets, but boulders dropping from night skies, shot from a pitching machine, without letup, piercing of agonies that once ago  
freshly desecrated and decorated my basic training in humanity.

Enough whining:
I wrote those poems to
eject out those pains,
and I write this now, once more,
to realize that so so many still face
uncertain and unrelenting similarities,
doing their own sums,
and I wish them easing,
strength to compose and
thereby dispose of
the ineloquent
and eloquent
words of staining suffering


3:30am
Thur
July 10
2025
Kelsi Herring May 2014
2:30AM* is for those who wake screaming
Those who lay with eyes wide open only thinking
That no one can hear them

2:30AM is for those who have lost hope
The insomniac who just choose to let go
Those so lonely that they teeter on decisions no one should know

2:30AM is those for those who try to put the pieces back together
The puzzles of their heart
Mismatched and out of place
Because all day you’ve hid how your puzzle continues to break

2:30AM are for those who are broken beyond repair
Too far gone to even care
They practice they’re smile
Put the stars in their eyes
Because tomorrow it’ll be time to put on show number 3,439
P.S it’s just one giant lie

2:30AM is not for those with their lives figured out
It’s for those people like me
Who feel as if they’re alone beyond belief
When really there’s an army out there who stand next to us in grief

...I hate *2:30AM
may 28//3:00pm
Nat Lipstadt Sep 10
"lie still and let it wash over you, the was and is and soon to be.
How frightening yet effervescent the next 24 hours. The lust, and musts of future days revert to the ancient past..."
patty m.
><
the irony!
when I am stilled,
the effervescence of me
unbounded, unleashed, and the torrential rain
of words fulfilling and departing from my interior

I am
a Grand Central Station
of trains labelled
"the was and is and soon to be''

all moving in an unscheduled mayhem,
but never crashing. never accidenting,
only accenting my racing against time,
my oldest and fiercest Super Villian,
and one just knows, never can you beat time,
time, that old rascally up his sleeve card magician,
who when shuffling the deck,
he knows
what was,
what is,
and here his red eyes gleam with satisfaction,
soon to be...

He and I,
old familiar adversaries
addicted to living.
never leave the table,
never leave a *** or
a poem on the felt,
and having always felt,
firm believed,
there will always be one more,
one more gamble, another day,
to write another poem
and turning my cards over
to reveal, to revel,
in my Royal Flush of creativity,
when time, smiling face,
with his
wild card,
**** time,
who trumps me for
it,
in possess of a Five-of-a-Kind(1)

~'
and the new players,
the young poets,
slap me on the back,
saying I had a great run,
but they don't know 'bout my
secret stash,
preprogrammed to appear,
long after these fingers
cease their tangled tango of tap dancing,
my dust,
my lusts and musts
will unstilled yet be
blowing, floating in the
soon to be
so ha!
                         nml
6:30am
Wed Sep 10
Twenty Twenty Five
(1)
The strongest hand in poker that cannot be beaten in a standard game is the Royal Flush, which consists of the Ace, King, Queen, Jack, and 10 of the same suit. It is the best possible hand in poker because it is the highest possible sequence of consecutive cards in a single suit, making it unbeatable unless there are wild cards in play, which would allow for a Five-of-a-Kind.
Cyril Blythe Aug 2012
I gulp down an Energy-Booster-X,
blue and sour.
Siri turns on Radiohead,
15 Step.

I step up to the pyramid of treadmills,
bouncing and salty.
Surrounded by Greek gods,
Beta, Alpha Gam, Pike.

I motivate myself by my surroundings,
bulging and ****.
Cardio first and then core,
2 miles, 200 crunches.

I connect my sweat in a line down my shirt,
blotchy and stagnant.
Everyone stretches in the end,
Thighs, biceps, pecs aflame.

I will not stop until I am perfection,
beautiful and sculpted.
Alarm set again,
For 6:30am, 7:30pm
Mathew walker Jan 2015
Stream..Crystal Palace vs Tottenham Hotspur Live ..EPL Game online
Watch Crystal Palace vs Tottenham Hotspur Live Stream
premier-league-livenetlivetottenham-live-streamchannel-1
Watch Crystal Palace vs Tottenham Stream online Barclays Premier League Live - Date & Time: 10 Jan 2015 - Free Sports Online Live Streaming and Highlights

[http://www.webtvhdstream.com/soccer-tv/][click here]

[link]http://www.webtvhdstream.com/soccer-tv/[/link]

Crystal Palace vs Tottenham Hotspur live stream: Time, TV schedule and how to watch the EPL online
SB Nation‎ - 4 hours ago
Alan Pardew takes charge of his first league game as Crystal Palace manager on Saturday
More news for Crystal Palace vs Tottenham Hotspur live stream
Watch Tottenham Hotspur v Crystal Palace Live Stream
cricfreetvlivewatchtottenhamhotspurvcrystalpalace17299­
Watch Tottenham Hotspur v Crystal Palace Live Stream Online , Watch Tottenham Hotspur v Crystal Palace Live Streaming , Tottenham Hotspur v Crystal
Crystal Palace - Live Streaming, Highlights, Full Match
https:livefootballvideocomteamscrystal-palace
Live Football Video · make money online  Queens Park Rangers vs Crystal Palace 12282014  Tottenham Hotspur vs Crystal Palace 12062014
Watch Crystal Palace vs Tottenham live stream free
ronaldo7netvideobundesliga-livebundesliga-live-streamhtml
Wa­tch Crystal Palace vs Tottenham live stream Watch this game live  Ver partido Crystal Palace vs Tottenham Hotspur en vivo gratis online Crystal Palace vs
Live Extra Schedule | NBC Sports
nbcsportscomlive-extra-schedule
All Games Available on Live Extra · CHANNEL FINDER  10, 12:30 - 2:30 pm, Premier League: Crystal Palace vs Tottenham Hotspur 2:30 - 3:30 pm
(W@-t-Ch)@ Crystal Palace vs Tottenham Hotspur Live
https:redditcomrTaken3hdcomments2rycos
3 hours ago - (W@-t-Ch)@ Crystal Palace vs Tottenham Hotspur Live Stream 2015 On-Li-Ne Enjoy!! (W@-t-Ch)@ Crystal Palace vs Tottenham Hotspur Live
LAvK Crystal Palace vs Tottenham Live Stream: Scores
redditcomrlavkcrystalpalacevstottenhamlivestream
3 hours ago - BBC Sport - Crystal Palace v Tottenham Hotspur bbc co uk sport 0  on Crystal Palace Crystal Palace vs Tottenham Hotspur live stream Time,
Matches on TV - tottenhamhotspurcom
tottenhamhotspurcommatchesspurs-on-tv
Full listings of when you can watch Tottenham Hotspur live on TV and what channel Spurs are on, no matter where you are in the  Crystal Palace, Away, 17:30
NBC Sports Live Extra - Live Soccer TV
livesoccertvcomchannelsnbc-sports-live-extra
Live Jan 10, 12:30pm, Crystal Palace vs Tottenham Hotspur [live stream], Premier League Live Jan 11, 8:30am, Arsenal vs Stoke City · Premier League Live
Nat Lipstadt Jul 2023
early daylight across my face sweeping,
gingerly ginger-yellow heated by the low-
risen sun, it confirms what my beating heart
yet signals, granted us, a new twenty and four,

but no more,

for certainty is not a human condition, so we cover
our eyes, not from the sun-rays, but in deference and
thankfulness and  gratitude, that we have one more chance
to the world distribute, blessed human loving kindness, unique,
the greatest gift most excellent we human possess to give away freely!

Jewely 23, Twenty Twenty Three
8:30am
Luminosity Cat Feb 2014
7:30pm - I am crying. Wars are raging. Demons are coming. My soul is dying.

8:30pm - Try to resist a knife that sits. Pick up the phone, just so alone. Try to resist the urge that pursists.

9:30pm - Urges pursist, I finally cave in. Marks on my skin, wage a war thats within. Spirits are fighting, demons are crying. A soul is dying. Tempers are rising.

10:30pm - My heart is breaking. My temper is flaring. My thoughts are rising. A God I'm denying. I'm lost, chained, and bound. I'm tired of fighting.

11:30pm - Alone in night, along in day. My friends seem to walk away. Still I am trying. Is there any reason to living?

12:30am - Sleeping comes naught to that who is crying. A God who has ceased caring. Is there any life worth giving?

1:30am - Trying to write to someone so dear, but words alas, won't come near. I cry out for help, hoping a God will hear. Hoping someone might just be there.

2:30am - I walk to the garage, a shotgun awaits. I pick up the tool, to send me to my death. I look for the bullets, none can I find. I go to the house, to look for a knife.

3:30am - I pick up a knife, to hold to my neck. I think back on the past nine years of my life. The rediculing, the name calling, the moving, the drinking, the hell that's broke loss must come to an end.
I think of a friend. Will she miss me, I wonder. I think to a dance that had not long past. A friend... I think naught, an older sister. I remember the song that she played for my ears.
I remember my mentor, the one who discovered. I remember her efforts to tell me they cared. I remembered her words that told me she would always be there.
I thought yet again to a friend who long past. I thought to her last words to my ear. "You're loved, don't forget it. Even if I'm not here."
I thought to years long past. When I layed in the grass, my brothers at hand. I told them I was running. His response, "No, don't go. I love you to much for that. I need you to pick on."

3:45am - I put down my knife. I go to my room. I continue to cry. I may not be happy, but my life I must live. My demons then flee, but my chains still bind me. An angel protects me, of this I am sure. To sleep I must drift, I'll wake in the morn.
SøułSurvivør Mar 2014
Summer 1986 Sunday 5:30AM

Misty morning in Malibu.
Seagulls stitch the sea to a subtle
silver sky. They sputter stridently.
Each elegant gull hovers effortlessly.
Entreating each other. Echos bounce
off the sound of the surf into eternity. The screeching of many a
soliloquy akin to silence.

I sit on the pier. The water before
me washes onto the staccato legs
of tiny waterbirds who wander
in and out of the surf. Little
windblown ***** of ecru and grey
wool. I worship in the womb of
the great goddess ~ nature. I wasn't to know the Creator was watching patiently...

6:30AM
I make my unhurried way up the
pier to my car. A cheap but
comfortable convertable. Nobody
walks in LA. I punch in a tape.
Don Henley. Boys of Summer.

I take PCH up to the incline that
takes you from the beach. Pushing
the pedal slightly as I slide by the
colossal bleached cliffs of
Palacades Park. There the homeless
sleep under the benches dedicated
by friends and family in
rememberance of loved ones.
Small plaques attatched for
posterity.

My hands are on the steering wheel
at 7 and 12 o'clock.I look at the cast
I wear on my right wrist. A token
of rememberance from an angry romance. He and I parted
respectively, if not at all
respectfully. I drive.

7:00AM
Venice beach. Not yet boysterous.
But never boring. The young people
(and old) still bundled together in bed. Saturday night hangovers will
be had by most of the denizens of
Venice beach boardwalk. A grainy
eyed few wander around abstractidly. Shopowners enter
their buildings, their storefronts
almost as small as booths. Graphitti
and giant works of art grace walls
everywhere ~ Jim Morrison and
Venus in workout leggings much
in evidence.

I smoke my cigarette and drink my
hot coffee carefully in the open cafe'.
I consider the eyefest of the crowd
that will congregate here to enjoy
the clement weather.
The cacophony and the clamor.
Touristas and Los Angelinos alike
drawn In by calculating vendors
and coyote souled street performers.
I look forward to seeing the
non conformity usually. But not
today. For now I sit in the quiet cafe'.

Venice beach. Vulpine. Vacuous.
A strangely vunerable venue. The
***** and the beautiful. The talented and the ******.

A street performance pianist trundles his acoustic piano on
casters out onto the boardwalk.
I ask him if I may play. He looks
at my cast doubtfully.
"I can still play..." I tell him.
He ascents and listens thoughtfully
as I play my compositions. He really
likes them. I ****** the ebony and
the ivory with insistant fingers.
The smile on his face is irrepressable. I smile back and we
flirt in self conceous, fitful fashion.
Time to leave.

9:00AM
Radio is on in my car now. A cut
from the musical Chess. One night
in Bangkok makes the hard man
humble...
I like the driving beat.
I'm going up I-10, a single blood cell
in the main artery that brings life
to the flesh of this mamouth town.
Traffic is tenuous. A boon here in
this conjested city.

I drive to Fairfax and Sunset, where
I lived with in a tiny one-bedroom
apartment with my mom. An
ambitious actress. I an ambivalent
artist.

Sunset. The Roxy and Whiskey-a-
Go-Go. Cartoon characters Rocky
and Bullwinkle casually cavort on
the top of a building. Billboards
as tall as the Hollywood sign. The
street of broken hearts for many
an actress -slash-model. They
wander about on street corners
looking haughty and haunted.
Waiting for who knows who to
honk. Their dreams have flown
away like the exhailation of smoke
from the mechanical lungs of the
Marlboro Man. Schwab's drugstore
and diner. The place where some
famous starlet was discovered.
Delivered into the arms of the
Hollywood machine. I opt to go
to the Sunset Grill.

11:00AM
I'm walking down Hollywood Blvd.
Perusing shops and persuing
pedestrian pleasures. Everyone
talks of the star-studded sidewalks.
To me they look tarnished and
filthy. Stars from a sultry smog
laden sky come to earth. The names
of some of the folks honored on
them I don't recognise.

I'm here to view movies today.
I'm definitely not going to
Grauman's Chinese Theater.
Been there. Done that. Gave the
very expensive T shirt to
Goodwill. I look around at the
proud and the plebian. The pedantic
and the pathetic. No prostitutes
out yet that I could see. Probably
toppled into bed to sleep
(for once). Deposed kings
and queens of the monarchy of the
night. The homeless hobble along
with their hair matted and askew.
Shopping carts with stuttering
wheels de reguer.

A couple of tourists with Izod shirts,
plaid shorts to the knee and deck
shoes sans socks gaze in a shop
window. It's borded by tarnished
and faded silver garlands... tinsel
Christmas tree.
"Want to buy a mood ring today?"
One of them querys his buddy,
laughingly.

I find my small theater and enter
the air conditioned lobby. I purchase
a soda and pass on the popcorn.
As I enter the theater's modestly
plush, dimly lit cocoon sanctuary
I notice very few patrons are here
for the matinee. GOOD. I finally
watch the premiere product of
Los Angeles. Movie after movie
slides across the screen. The callus
morally corrosive corporations
conspire with the creative to produce
the culmination of many art forms
in one. Cinema.

LA. Languid. Luxurious. Legendary.
Rollicking, raunchy rodeo.
Seaside city. Sophisticated. Spurious.

SPECTACULAR.

8:00PM
I wend my way up Mulholland Dr.
Another tape is playing in the deck.
One of my favorites. David + David.
Welcome to the Boomtown.

I pull over at a deserted vista. From
this viewpoint I can see the city
spread out like a blanketfof brilliance. The gridiron of LA.
Glitzy and glamorous. Generating
little gods and goddesses. A gigantic
gamble for the disingenuous and
gouache. Tinsel town. Titillating.
Tempestuous. Only the very brave
bring their dreams here... or fools
rush in where angels fear to tread.
All but the fallen angels. They thrive.

Oh! If this place could be bottled it
would be such sweet poison. I
look up at the auburn sky and back
down at the breathtaking panorama
The metropolis that is LA with awe
and angst. I carefully stub out my
cigarette and flip it irreverantly
toward the lagoon of lights.

I get in my car to drive home.
Home?
Could this imposing, inspiring,
impossible place be called home?

Well. Home is where the heart is.
And I live in the heart of a dream.
This is the city of dreams...

CITY OF ANGELS.

Soul Survivor
Catherine E Jarvis
(C) 2005
You can rest your eyes now...

I only have enough funds to
produce one spoken word
set to music... should I
do this one?
Sarah Mann Mar 2018
This morning I woke up before 6am.
Too early for most people, myself included.
My brain was running wild last night.
I laid restless in my bed for what seemed like hours.
I tossed and turned and my thoughts were overrun with nightmares and horrors.
Turmoil took over my mind and stressed my heart out. I simply couldn’t sleep.
I took deep breaths, I counted sheep, I even drank a cup of tea.

Nothing worked. So, I continued to lay there too tired to move, far too awake to fall asleep.
Such a terrible state, caught in between two extremes each one refusing to give in.
Life had exhausted me and yet I still wasn’t allowed sleep.
I felt trapped, I felt powerless, I was defeated.
Somehow amidst my worrying, I had drifted off into slumber.
And that leads us to this morning.
This morning I woke up before 6am. Groggy, vision foggy, and most of all still tired.
I mean, could you blame me? I had gotten barely more than half
of the prescribed amount of sleep for someone my age.
I packed a bag for the adventures of the day, which for me meant about 30 pounds of textbooks.
I made a list of the work that still needed to be done.
Another list for how many minutes I had before the sun.
One by one, we loaded into the car, like soldiers preparing for war.
In some ways, we were readying our armor, but ours was metaphorical rather than literal.

My dad is always the first to the car. He likes to get ahead of the current.
My sister is second, she’s grumpy and doesn’t understand what’s going on.
Then myself, I’m tired but still excited for what’s to come.
We drive through the sleepy city, everyone’s preparing for their own day.
The sun itself has just risen and we watch the world awaken.
We have arrived, and it’s about 6:30AM.
You guessed it. It’s time for breakfast.

Scientifically speaking, breakfast is the most important meal of the day.
Personally speaking, nothing chooses the course of the day more than that first meal.
A cold unforgiving bowl of cereal doesn’t bring me happiness,
Like a warm bowl of fried rice does or like scrambled eggs with just a hint of cheese does.
Perhaps I am looking too far into the way certain breakfast foods makes me feel.
Regardless, we walk in and the environment shift affects all of our moods.

We made it to the front of the line and we order.
For my dad, eggs, bacon, and link sausage, a trio.
For my sister, in a state of dazed, orders the same.
For myself, the only one with originality deliberately chooses blueberry pancakes.
The warmth and comfort found in hot chocolate is exactly what I need right now.
So I order that too.
Sleepy and unaware, we trudge back to a table as a unit.
Our table is split between booth and chair and it’s located next to the window.
There is something poetic about the scene.
Maybe it’s the early light breaking through the glass.
Or maybe it’s rarity of the event, we usually eat breakfast at home.
This is a special occasion not for any reason other than it’s happened.
Moments of solemnity are interrupted by our waitress who brings a new day.
Found piled on top of flimsy paper plates is a sight of pure beauty.
Maybe it’s the lack of sleep, people tend to experience life more deliriously during this time.
But the food looks incredible. The pancakes are lightly coated with powdered sugar and
look like they had been pulled out of a magazine cover, as does the rest of the food.
My father and sister’s moods are lightened as food typically has that effect.
The hot chocolate is topped with whip cream and sprinkles something that I didn’t ask for and yet I’m endlessly grateful.
They bring a previously unexamined aspect of happiness to this already novelty of an outing.
Once the food arrives, I halt the instincts of everyone by forcing them to capture the moment.
I enjoy pictures because they are snapshots of reality, that can depict whatever you want.
They take time and turn it into moments, something truly innovative.
After the pictures, we eat, we make small conversation,
And most of all we enjoy each other’s company.
It’s similar to the breakfasts you often see out of movies, families living that idyllic lifestyle.

This morning I woke up before 6am
And only got 4 hours of sleep.
But despite all odds, this was a good morning.
Now I’m not sure if this change in mood is attributed solely to breakfast
Or other unmentioned factors but I do know this.
Physically, I feel tired.
Mentally, I feel better than I have in a while.
Perhaps, I can even persevere through the day.
I guess that’s just the power of blueberry pancakes.
2:33PM Wednesday, September 27, 2017
Nat Lipstadt Sep 2013
new year notes to self at 4:30am

too cynical
to pseudo-resolve stuff
just because
an arbitrary mark
the calendar affords.

nonetheless,
the mind endlessly calculates,
then recalculates,
rinse and repeats,
responsibility, "success,"
middle class living death

pretend erase the slate,
as if this prologue was not
a sequel,
but the..

the squeeze of guttural noises
stuck in my throat
prevent raucous breathing,
stifle noisy disbelieving,
lest I awake all the babes
sleeping cozy nearby,
trusting in me,
so I communicate
to the others
who are awake
at 4:30am,
offering them but
a plain white lamentation,
cry with me,
"I know, I know."

Jan 3, 2013

.
4am On the drunken floor of my Wingmans apartment I place my red solo tankard down to instigate a quest.
"ROADKILL!"
That's what we call my wingman.
"Roadkill! Lets go on an adventure to king richards faire tomorrow!"
"Sure! When do we leave?"
"Don't worry, I'll wake you up."

See. When your best friend says they need you,
you don't just call them.
You drive.
Tonight,
on the anniversary of Roadkills worst tragedies,
we are getting drunk.
In the morning,
We're going to prove that life is worth living.

7:30am our alarms go off.
"Uhhhg."
"Curse you phone."
Hands slap towards the noise,
Spilling last nights wounded soldiers.

"Roadkill your shirts inside out."
"Thanks man."
Actually, while you have it off.

Black doesn't go with brown.
Pick a whole different shirt."
"It's fine."
"*******. There's a blue shirt right here."

Belting sailor shantees
Roadkill and I adventure three hours in
My four wheeled ground Zepplin.

"A curse to you lads,
a curse on your head,
Drinking pint after pint
until I am dead
I just keep drinking
and I don't know why,
But tonight is the night
that I drink 'til I die!"

Upon arriving at the faire we spot an ocean of goregeous maidens.
The ticket booth doth not take credit cards, however.
So we needed to speak to the gatekeeper.
"Excuse me, where's the atm?" I Ask.
"it's right over there, Handsome.
I'll need your id's first, though.
Don't worry, I don't bite
... hard."

Roadkills eyes grow the size of stormwind.
"I need to bring you everywhere man.
You make everyone love us."

we return with cash in hand
The gatekeeper pulls our ID's from her corset
looks them over before handing them back.
"How are you boys younger than me?"
"It's the beard. "
I wink.
"Keep a secret?"

Swords on hips
songs in chest.
Mead was flowing
Boots were clomping

Roadkill paused to look around
Standing like a pleased statue.

I bounced excitedlly around like a child.
ROADKILL
LOOK AT ALL OF THESE GOREGEOUS OUTFITS ON THESE BEAUTIFUL WOMAN!
"Hey!"
handsome men, too.
"Thank you"
It's like we teleported to Flurb heaven!
Look!
a garb shop!
Oh my god
A boot store!
They have a whole store
for leather larpy boots!
There is a tail shop!
I could buy and wear a fuzzy furry tail!
This is amazing!
There is a giant duck
Being pushed back and forth by two huge jacked dudes.

"I need to hug everyone!"
I am in love with everything!"
"Can i please hug you?"

"I swear to god, Nick if you touch me."

We try the knife throwing challenge.
The crossbow challenge.
The dart throwing challenge.
We **** at all of it but we have a blast.

We walk into a leather shop.
A small redheaded girl dances around us. She puts fur around our necks
Her hands trace our chests as she ties them up
You boys look like the type to rock these.
She drags us by the belts to a mirror.
Look at how handsome you both are.

"Roadkill" I whisper.
He is already lost in her eyes.
I place a hand below his chin and close his mouth.
They talk about where they're from.
Their families.
What they do for fun.
"Oh you do larp? We do dagohir it's like full contact grappley shield kicking larp"

A group of customers walk in and she leaves to tend to them.
A brunette helps take off roadkills stole.
"How much are these anyway?"
Roadkill asks the brunette.
"$600" she answers.
"I feel ashamed for even trying it on"
Says roadkill slipping off the precious treasure.
"Goodbye ladies! have fun today!"
I say, pulling roadkill by the arm.
"Oh... okay then... bye."

"They seemed sad we left.
What was that about?" Asked roadkill.
"Well do you want the blunt educated version or the ignorant positive version?"

"Ignorant of coarse."
Then they're dissapointed because they were interested in us.
"Out of curiousity, what's the blunt educated version?"
"They're upset We didn't fall for their act and buy their expensive wares."
"Whelp... there goes my self confidence. Ignorance really is bliss"
"Yes it is roadkill. Yes it is."

We Travel back home.
Again, singing sailor shantees.

"A curse to you lads,
a curse on your head,
Drinking pint after pint
until I am dead
I just keep drinking
and I don't know why,
But tonight is the night
that I drink 'til I die!"

Park the four wheeled ground zeppelin in front of the Apartment.
Clonk our boots up the stairs
Grab angry orchards out of the fridge
Slunk into the beaten brown couch
raise my bottle into the air
"To living one more day exactly the way we want too, Roadkill."
Roadkill raises his bottle.
clinks it against mine.
"To living."
"I love you, Roadkill. You're the best." -Geek
sapthepoet Oct 2012
Before I moved to New Mexico
I never thought that I deserved to be in college
Because In California I got bad grades, skipped classes,
Didn’t care about my life and played the victim in high school
Now I’m pursing an Associates and a Bachelor’s Degree
In Liberal art, education and creative writing

I wasn’t sure if I had what it takes to lean on God’s faith
To complete my classes and do well
In that secondary education knowledge
I but I passed my summer with a B+

In my life I’m known to be late for everything I attend
Yeah I was always on that black people time
Waking up at 4:00 am to get ready, eat
And also catch the bus to a summer class
That starts at 8:30am and ends 12:50pm
Every Friday for 3 months was difficult
But I learned to make sacrifices and
I never missed a day of class

I had a bad habit of being a procrastinating excuse maker
But I was tired of wasting time,
I hated proving people right about me
I was tired of my family treating me
Like I was a burden on them
And having haters trying to destroy my spirit
So I could do what they want me to do
So I pushed passed the negativity and I never fell behind

I’d never had a scholarship before
But my first year in Central New Mexico Community College
I received 2 scholarships and I’m going for another one

My mentor used to tell repeatedly
That anything in life that’s worthwhile takes hard work
So try, when it doesn’t work try again and
When you feel like giving up, try even harder
Because a man has no excuses, rich or poor

Now I know 100% that anything is possible with God
And a lot of effort on my part
So I won’t ever quit, I’ll stay motivated and hungry till I have nothing left
Because I’d rather die trying my best than live with regrets.

By Shannon Pollard
©Summer 2012
Anais Vionet Feb 2024
This was last Saturday night. We were at a rooftop party in downtown New Haven thrown by ‘DocHouse.’ Doc-House is kind of a frat-house, owned by Dr. Melon, where he and seven doctoral students live. My BF Peter lived there once - before he graduated and took a job in Geneva - that’s how I met Dr. Melon. I think Peter asked Melon to ‘keep an eye’ on me - because he texts me an invitation every week and people with multiple doctorates and doctoral students don’t usually hang with lowly undergraduates.

The invitation said ‘rooftop’ but we’re mostly on the third floor - not on the actual roof - because it’s about 39°f and windy out there tonight. The floor space was about seventy by a hundred feet, there were pillars but no walls. The space was lit by a million strings of white Christmas lights.

The party was packed and loud - so loud I was wearing ear plugs. Beach chairs and card tables were the furniture. There were foosball, pool and two ping-pong tables (one of those being used for "Beer Pong"). A karaoke machine patched into two Marshall amps and speakers acted as a DJ.

Of course, there was a bar. Everyone was supposed to bring something. We brought two bags of ice, two magnums of Gordon's gin, two fifths of Cinzano vermouth, a jar of large green olives and a box of toothpicks, because there’s always room for the proper anesthetic. Martinis aren’t a shiny, new hobby with me - they’re a lifelong passion that I only indulge in on weekends and in psychologically safe environments.

There were 7 in our party - Sunny, Lisa, Leong (three of my suitemates), Lisa’s BF David (a Wall Street M&A man), Andy (a carrot-topped chain-smoking divinity-school undergraduate friend of Sunny’s), Charles (our escort, and driver) and me.

We’d been there about 30 minutes when Jordie, a guy I’ve been sort of crushing on for several months, showed up - alone. Lisa turned to me and yelled, “Uuu, lookie lookie,” when she saw him - I barely heard her - but I read her lips. I’d never really talked to Jordie, but when I looked at him, through the warm, martini mist, my tummy felt like Jello-excitement.

As the night wore on, Jordie and I started hanging out. We lost at foosball, 8-ball and ping-pong before we went up on the roof to get some air. The silvery ½-moon crescent was obscured, off and on by clouds, like a shell game where the moon was a jewel on blue velvet. You could almost hear the operator’s smooth, practiced patter, “now you see it, now you don’t, place your bets.”

It was quiet up there, so we actually talked. Somehow, the vast night seemed intimate. As we talked, the conversation was delicate and careful, like the words were made of crystal.

A while later, Jordie and I were back downstairs dancing. The entire floor was coated with that gray-speckled covering - so you could dance anywhere - but a rectangle of police tape in that flooring defined the official ‘dance floor’.

Two hours later, we were watching Sunny sing karaoke while holding a fuchsia martini (just add raspberry liqueur) in one hand. When Sunny goes, she totes commits and belting out an angry, screamo version of ‘Ain’t it fun’ by Paramore, she tried for a Beyonce-like head-spin (don’t try this at home), and slung half of her drink on the crowd - but it didn’t slow her, or them, down. After finishing, to huge applause, she took several bows and coming back to our table, she asked Andy, “How was I?”
Andy held out his hand and lampooned her by waffling it, in a so-so gesture.
As Lisa handed Sunny a replacement cocktail, she told Andy “You don’t get it - it’s supposed to be awful.”
“Then it’s the best version of the song I’ve ever heard.” he replied, holding up his hands like she had a gun.

Jodie and I danced some more and after a while, someone played a slow song. As we moved close together, his subtle, boy musk was torturous and intoxicating. How come guys smell better when they’re all sweaty and I smell like a horse? Eight weeks of lonely boredom and three martinis (4?) were almost enough to churn the sweat of desire into the intoxicating liquor of consent. In my secret heart I wanted him. Badly. I wanted to take him home and smash against him for hours. Alas, I have a (missing) boyfriend and I don’t believe in oopsies.

At that very moment I saw Charles, standing silhouetted in one of the dance floor lights - he had our coats in hand. I swear, that man can read my mind. I glanced at my watch, 2:30am. I stopped close dancing with Jordie and stepped back. “I gotta go,” I told him.
“It was fun,” he said, shrugging and smiling.
“It WAS fun,” I agreed, taking my coat from Charles who’d come over. “(I’ll) See you next week,” I added, as everyone in our little caravan started to move.
BLT Marriam Webster word of the day challenge: Lampoon: to ridicule with harsh satire.

totes = totally
Tiara I S Mar 2019
I feel like a waste of time
My stomach boils with pink pills
Eyelids droop- I pry them open
To drink words I thirst for
Taste worlds I yearn for
Sludge pools in from the bitter thoughts
Soaking soaks- soaking sponges
Run and drain out the membrane
Everything is all too much
I seem to never be good enough
Renjith Prahlad Aug 2011
Kalippaattam
------------

              ---Renjith Prahlad
                        (27th AUGUST 2011-12:30AM)



Vimookamaayoru sundara swapnam ente kannukale yaanthrikamaaya ee lokathilninnakatti
bhaavanayile mohanabhoomiyileku yathrayaakkunnu..Ennal Ivide kanunnathu yaadharhyathil
aroopiyaaya ente mohangalude kadanjedutha swaroopangale..ivide kelkkunnathu
yadhaarthyathil uumakalaya prathyaashakalude imbamaarnna prathidhwanikal..
Ivide enne sparshikkunnathu yaadharthyathil maravicha ormakalude jeevanulla viralukal..
Ivide njan anubhavikkunnathu yaadhaarthyathil oru pazhjadamaaya ente, chetananiranja
chalanagal..allayo Swapname ethakshayapaathrathil ninnedukkunnu nee ithratholam
jyothithullikale,ente raathrikalil prakaasham choriyuvaanaayi..Pakshe, oru maathrayude
maathrayolam polum illallo ninte aayussinte dairkhyathinu...Kizhakkile chakavarthiyude
udayam asthamippikkunnathu vimookamaaya aa sundara swapnathinullile sooryane ..
Kizhakkile chakavarthiyude sobha vazhithelikkunnathu swapnathil maathram
swathanthranaya ee kuthirayude adimathwathilekkulla thirichupookkine...


Njan oru kuthirayaanu..jeevashavamaayoru kalippattam..Enikku chaadaam,odaam,
shabdamundaakam..pakshe ellam oru thaakkolinte kanakkinanussarichu..,oru kurunnu
baalante manassinanussarichu..avane rasippikkuvan kazhinjal..avante viralukale
anussarikkan kazhinjal enikku kure neeram chalikkam..kalankamariyaathorukuttiyude
adimayaayi eere naal jeevanillathe jeevikkam..ente suhruthukkale...shashvathamaayoru
maranathe polum aagrahikkan avakaashamillatha ente ee janmam shapikkappettathalle...
Niraveettan aavathillatha Aashaakalum mohangalum ente manassil kumilukalaai pirann
anthimam parasparam thattichithari athmahathya cheyyunnathu shaapameetathinalalle..
avarozhukkiya chorathullikal polum adimakalaakunnathu shapikkappetta ente
manassinullile irunda shoonyathayilalle..Nikoodatha koodukoottiya vanangaliloode
paanju pokuvaan..Marangaleyum pakshikaleyum pinnilaaki kodumkaattinte gathiyepolum
athijeevichu oru kuthirayude lokathekku raapaarkkan..sharamazha peyyunna yudhabhoomiyileekku raajyatinaayi poruthunna sippaikalude naduvileekku, raajaakkanmareyum padathalavanmaareyum purathiruthi avasaana shwasathe sharangal thulachukeerumvare dheeramaayi poraadi maranamadayan oru kuthira aagrahichaal athil thettilla,pakshe oru kalippattam aaya kuthira aagrahichaal
athahankaaramaakunnathengane..Kalippatamenkilum kuthirayalle njanum..Enikku mathram
enthe aagrahangalkku neere kuda nivarthendivarunnathu...Enikkuchuttum maathram enthe
kudakkyu keezhe athimohangal nizhalikkunnathu..

Ennal, Kudaykku keezhile ANDHAKAARAM oru divasam enikku thannu, Irulil janichuveenu
shwethajwaalayayi valarunna swapnangalee..Kalippattamaaya njan annumuthal andhakaarathe
snehichu thudangi....kaaranam Swapnathil njan kalippattamalla..jeevanulla kuthirayaanu..
Njan adimathvatinte theerangalilalla, swaathanthriyathinte ananthasamudrathilaanu..
Vimokamaaya aa sundara swapnam vechuneettiya sowbhagyangale enikku nishedikakkan
kazhinjilla, yaadhaarthyathilekku oru madangipookkinu ente manassu madichu..
swapnavaathilukal orikkalum adayalle ennaashichu..pakshe ente mohangalkkethirayi
swapnasooryan swapnachakravaalathileekasthamichu thudangi..swapnavaathilukal adyaan
thudangi.swapnagale swanthamaakkunna swapnangal kanda njan, ente madagivaravinaay
kaathirikkunna yadharthyathe avaganichu..swapnalokathe sweekarichu..Vilangukal
pottichodunna kuttavaaliye pole njan odirakshappettu..Yaadharthyathinorikkalum
ethippedaan kazhiyaathathra doorangalilekku njan yathrayaay..pakshe, Aashakalum
Mohanglum niraveettiya santhoshathinte velicham amithavegam polinju..Kalippatamaay
jeevichirunna lokathorikalum anubhavappettittillathoru thalarcha ente shareerathe
aswasthamaakki..Marubhoomiyile mantharikal orittu mazhaykkayi kezunnathu pole ente
thondayum oru thullidaahajalathinay karanju..divasangal kadannu poyi..swapnathiloodeyum
narakathe praapikkam ennu njan manassilaakki...Vikruthmaayoru aantharikathe maraykkunna
ente swapnamohangalude kadanjedutha swaroopangalekkal ethrayo dhanyamaanu, roopamillatha
ente yaadarthyamohangal ennu njan manassilaakki..Vilaapaswarangal maathram paadunna ente
swapnamohangalude prathidhwanikalekkal ethrayodhanyamaanu, uumakalaya ente
prathyaashakal, ennu njan manassilaaki.Enne jeevanode njerukkunna ente swapnamohangalude
viralukalekkal ethrayo dhanyamaanu, maravicha ente yaadarthya ormakal ennu njan
manassilakki,Ennil ninnum chethana oottunna ente chethana niranja chalanangalekkal
ethrayo dhanyamaanu,oru kurunnu baalante chundilpirakunna punchiriyude maathru
janmam, oru paazhjadamaaya kalippaattathinte janmam...ennu njan manassilaakki...

         -----------------------------------------------------------------­

Vaathilukal pinnum thurannu.."Madangivaru kalippattame"..Kurunnu baalante chundil veendum
oru niranja punchiri pirannu...

                           -----Renjith Prahlad
Joe Bradley Jan 2014
The phone rings:
It doesn't work anymore.

Diazepam, Red wine, 6:30am, hip replacement,
Plunger, television, boxes of photos, carslberg, peroni,

The flush is broken on the toilet.
I've sat for 15 minutes.

Examination, xbox, unemployment, skunk,
Washing machine, dishwasher, dryer.

It's raining, Old towel and bucket
under the hole in the roof

Cat food, cod liver oil, mould, 8:45pm,
3pm, appointments, 12pm.
Laptop, silence, phone calls,
Toilet, bucket, bleach,
Oven cleaner, kitchen roll, dirt, carpet,
Television, Hoover,
emma l Jul 2017
the early morning silence is good for me

i usually miss out on the sunrise,
but when i don't, i let myself soak in it

my fingers prune under the rays of a sun unreleased

this in-between --
the not quite day, but not quite night --
sets my world in motion

time stands still and life forms inside my window pane

bliss in a 5:30AM lilac sky

the early morning silence is good for me
good morning
Nat Lipstadt Jun 2013
Just Like A Woman

You focus on the act,
The ridiculous derring-do,
Laughing at me
Cause I chased away
In my rumpled ******,
The woodpecker that **convulsed

Our house at 5:00 AM,
With a decorative pillow.

Focus on the results, says the
Results-oriented man.

Has Woody ever returned?
No and his fate is still unknown,
He may fly forever neath our trees,
But now he knows to stay away
From me and the risk of my pillowy pillory!

P.S. I may (or may not)
Choose to disclose
That upon my return
The house still shook,
From someone's uproarious, convulsed
Laughing at a city boys country heroics.


10:30am
June29 2013
Certain people maintain it was the horrific/comedic sight of me that drove him away.  No matter, its the "bottoms"  line that counts
Chris T May 2014
Alarm - 7:30AM
Gonna cook.
Eggs. Bacon.
Read the paper.
Jog in the park.
Be productive.
I'll... I'll...
***** it.
Alarm - Off.
Gonna sleep.
Audrey Lipps Nov 2014
Her hand grazed my knee first;
black nail polished fingers
filled with golden rings and solitude

Her hand slid up past my knee next,
A chilling whisper of a husky voice,
"I'm bisexual, whatever, who cares?"
A tone so sleek, so ****,
Uncaring and unrelenting

Her hand moved inward this time,
her warm breath pressed to my neck,
questions of sexuality and culture
in her ******* rasp and
I melted that way, I ******* melted that day

A level booming below,
A band of drummers,
Drumming of ambition and heartbreak,
A base-dropping attitude from Athens

She leaned in first, her smoky green eyes
******* mine and I looked up,
with a feeling of hot temperance on my tongue,
She kissed me,
sweet and bold and the evening was full
of firsts because she grabbed me,
so fast and forward and
dimmed the mood and began her journey
into transcendental fluidity

We swayed to the beat of casuality,
a beat unfamiliar in my world of seriousness,
and she grabbed my hand and pulled her lips
closer, closer
and whispered "I'll get us a taxi"

Beautiful women make my heart flutter,
and beautiful women with smoky green eyes
and blonde dreadlocks make my speech stutter
but I followed her into the abyss of wonder
holding her hand onto the grassy concrete,
our breath white and our spirits hazy

The taxi home reminded me of New York streets,
and it made me forget of Oxford priorities and
senseless irony and she kissed me twice,
her **** fingers searching for answers
in the 2:30am moonlight

She kissed me in the elevator,
A familiar scent of the haunted ancients and
her sly character left me breathless, an
adventurous eighteen-year-old searching for
wisdom and a twenty-something searching for
a definition, we collided

Her dorm, lined with yellow lights and
colorful elephants, a comforting essence of
security and warmth

She grabbed my waist and
turned me around,
I lost my breath in her
seductive sway,
She kissed me hard and pushed me fast,
onto her pillows of a cool fragrance

She screamed once and I screamed twice,
A fantastic pain muffled by the sound
of old heat lamps

"You'll forget this," I said
"Please," she said, "I'm practically sober."

We continued for hours, her spirit quick,
unceasing,
persistent
She smiled exquisitely,
with slanted eyes, she licked her lips

We slept soundlessly,
Her hand where it started, above my knee
and below my waist,
Black nail polished fingers held
my hand until morning,
a soft kiss on the shoulder blade
and I awoke to the chirping of morning

And I left with a sense of softness,
not accomplishment and
I'll see the smoky-eyed,
yellow-dread girl once more,
And I hope it's when I don't know
what
for
I wake up in the morning at 06:30am
past or not in the winter
it in the morning
Then I go to the toilet washing away all my intestines
It is my daily  routine
Take all my clothes off looking at my goose bumps it still my daily routine
Going into the bathroom then brushing away my germs in my teeth
it still my daily routine
Taking my bath cleaning away my pain after dressing and creaming
next am dressed ready to take a 242 bus to school
the next thing I know am late
My daily routine is pain!
NitaAnn Dec 2013
Each night the little girl builds a fortress of pillows and blankets to protect herself from the irrational fear and the very real nightmares that overtake her in the darkness.  She forgot to build that fortress last Friday night...and left the extra pillows on the floor and the bear she sleeps with in a chair.  The above facts were brought to my attention the next night as the hus was heading to bed.  As typical, he exits the man-cave and stands in the hallway and announces that he is going to bed (as though I'm unable to see him?).  Then he says, as he says every night, "Come hold me?"...knowing that I will say, "Sure, I'll be right there." but 'right' really represents several hours...  Last night there was a slight deviation to our nightly verbal exchange as he said, "Last night you didn't build your fortress and I don't know what was going on but I woke up at 2:30am and I had like 6 inches of space in the bed because you were so close to me."  Hum...I guess I took the "come hold me" phrase seriously on Friday night.

I don't know why the deviation from my normal set up...but I do know that there is this desperate little girl inside of me who longs to be held, but other, more 'grown-up' parts inside of me who know we're supposed to be beyond that now and it will never be - nor will they ever allow that to happen.

I also know that a lot of the time it's difficult for the hus to understand where I am and what's going on with me...I can't even begin to explain it to him when I often don't know myself.  So I tend to air on the side of "quietness" in my communication with him too.  In other words, I don't often take off the mask in front of him, or ask him for help.  Part of me feels bad for him…I recognize that's it's difficult to have a relationship with someone with my history, and I can be more than a handful (understatement...understatement...) and it isn’t easy for anyone to stick with 'us' through the bad times...the really bad times.  I get that - and not just with him.

That's why I pull away instead.  It's difficult enough for me to deal with all the different and conflicting parts of me - how can I expect anyone else to do it with me?  The one who aches for reassurance and care, the one who sabotages any attempts to act like a sophisticated adult with her fears and desperate and confusing needs.  The one who aches with the desire to be loved, saved, fixed…on a never-ending search for something to make her feel whole, safe, "unmolested".  The sophisticated adult…the professional cold grown woman who hides her insecurity by pretending to be self-confident...some even call her 'stuck-up'.  The party girl who can only react to situations with humor and laughter even in the most inappropriate times.  The little girl who desperately wants to be held safely by someone who will not hurt her.  

How can anyone else get through to all of that?  I can't do it and believe me, I've tried.
Today, the sophisticated adult is holding steady at the helm...on 'therapy' day, which typically means she will act as though everything is great with the world, even though inside, everyone else is screaming and suffocating under the weight of the fear...sadness...anger...shame... hopelessness.  And it is virtually impossible to break through that exterior because she holds the key to lock others out...particularly the therapist because she needs no one, and that holds double for someone who told the 5 year old to "deal with it" because she is busy...and "make another choice since it's after 10 and the closed sign is out"...after being there way after 10 for the little girl for 2 years.

And then, late tonight, when the wind howls, and the snow begins to fall, and the coldness seeps inside of this body and weaves its way up my spine, the desperation will begin, followed by the crying...then the overwhelming fear and hopelessness that will be unrelenting and she will be inconsolable until she cries herself into a restless sleep and wakes up tomorrow with a migraine and swollen red eyes.

You might be thinking, "Nita, if you KNOW that's what's going to happen then can't you stop it?  Can't you make a different choice and let the therapist try to help you?"  

I don't know why it all seems so out of my control - I can watch it play out but I cannot intervene or stop it.  I wish I could...she won't let me use the key either to unlock the door.
antxthesis May 2015
4:21am
hi, how are you? i hope you're okay. hope you're doing fine. I'm sorry, I've just been thinking as always. you've never said it, but I'm sure you've thought: "you think too much"

4:24am
these past days haven't been going easy you know, and i think you know why. I'm sorry, you're just always on my mind.

4:25am
I'm sorry, it's kind of cold, the fan's on and windows' ajar. was just wondering if you'd hold my hands, I've never felt your hands before, and you've never felt mine. I'm sure they feel like silk, (soft and smooth).


4:26am
i miss you and I'm sorry i came by so late. sorry i didn't know you before. sorry i didn't know you before things changed. sorry that our situation is just not right.

4:28am
it's getting late and I should be sleeping, but i just read something and now i can't take my mind off you.

4:30am
have i ever told you that i love your smile, and there's this "quiet" thing about you that i love. i hope you keep smiling, hope no one ever makes you cry. hope that you're always alright. one of us has to be.

4:32am
i wished things didn't end the way they did. i didn't predict our ending like this. didn't even predict an ending.

4:33am
wish it wasn't so hard seeing you. wish things would go back to normal, wish i could turn back the time to when we first met. ****, those were the best couple weeks of my life. i think they were the best for you too.

4:35am
i still reread our past conversations and they still make me laugh.

4:38m
it's getting late, and i don't know what to say. i love you? still do. and always will. true love never dies.
-h.s.
okay so this was inspired by something @engimuse wrote
Eric Bergeron Feb 2021
6:30AM
I wake up, completely exhausted, my mind running a million miles a minute

I am alive...

As my legs swing over the side of the bed and my feet hit the ground, I slowly rise up

I am strong
I am alive

I wipe the sleep from my eyes, preparing myself to face the day ahead
Give it your best shot world. Whatever you throw at me, I will overcome.
For I am alive, I am strong, and I am a warrior.
Anais Vionet Jul 2023
Lisa and I were watching one of our favorite series last night, a Japanese manga called “The Way of the Househusband” and I could barely keep my eyes open. I went to bed at a decent hour (11:30) but when I got in bed, I couldn’t sleep, I just laid there. It was rude and caused me to oversleep.

I don’t mean to brag, but I can go from oversleeping, to bushed and showered in less than 15 minutes, I’m really a marvel of efficiency (with still wet hair), especially since we wear scrubs.
I grabbed my iPad, stuffed it in my rucksack, and hey, I was ready to go.

In the living room, it took me a moment to situate myself - it was a very noisy and disorienting environment - what with Lisa yelling at me for running late, but soon we were off.

Just a girl, her lemon ginger Kombucha, and her angry roommate, ready to face the world.

We stepped out into the morning and.. Ughh! I’d forgotten my AirPods. I double checked, not there.
Lisa gives me a threatening look. “PLEASE,” I begged, desperately, “MY AIRPODS!”
“OH, my GOD!” Lisa said, glancing, irritatedly at the Apple Watch I gave her for her birthday.

I ran up the stairs and was back in NO time, really, really ready to go.
Just a girl, her Kombucha, AirPods and angrier roommate, ready to face the world.

My sister’s apartment is about 7 walking minutes from the hospital. As we were walking, I had my AirPods in and was rolling with Kanye. I in NO way endorse his CrAzY. But If I start the day out, with “Through the Wire” and “Jesus walks,” I’m tweaked for whatever gamut Rebecca (my surgeon) has in store for me. I paused the slaps, momentarily, as we passed a herd of boys, but I was bouncing again in a blink.

Lisa and I are in the second week of our two-month, summer fellowships - shadowing surgeons (different surgeons) for “clinical experience.” The first thing I do every workday morning is bring Rebecca a large coffee (from the cafeteria). She comes in at 5:30am every morning of the week and leaves God-knows-when - certainly, well after we do at 4:30pm.

She spends the three hours before I come in, reviewing patient notes and surgical plans. I gently rapped on her open door. She doesn’t look up, but she knows it’s me.
“Good morning,” I whisper, Rebecca’s seated at her desk, working on her laptop. I set the coffee on her right side and after I remove the pre-existing empty cups, I hesitate.

“What’s up,” she says, leaning into her screen to check something as she keys to enlarge it.
“I have a small question,” I say, “Are we supposed to be filling out timecards?” She doesn’t say anything, continuing to examine the - whatever. After a few seconds, I added:
“Quinn said we have to fill out timecards.”

“Did he?” Rebacca asked, rhetorically, after a bit. She’d stopped studying the screen and gotten a faraway look. Then, after another moment, she said, “Well, bless his heart,” which made me chuckle, because we’re both southern girls and that’s shorthand for “f**k him.”

“Thank you.” she says (for the coffee). I’d been dismissed.
We have rounds in twenty minutes.
BLT Marriam Webster word of the day challenge: Gamut: “a series of related things.”
That One K Kid Jun 2017
Late into the night
I remember everything.
Every thought I've had,
Every word we've spoken
But somehow
With every toss and turn,
And every attempted escape of the mind
I cannot remember how to fall asleep
karvee tamba Jun 2014
She is quiet like the sun.

She reads all day.

She sits alone.

She has no friends.

She tells no one nothing about how she feels.

She simply just sits and reads all day.


She says she understands that her mother is busy all the time.

She says she understand that her father died two months ago from cancer.

She says she understands that her mother has two jobs.

She says she understands that she has to make her own dinner every night.

She says she understands that she has to stay home alone every night.


Ring! Ring! Ring!

Molly answers the phone.


[ Hello Molly .]

[Hello Mom.]

[ Is everything good tonight?]

[ Mom everything is just fine.]


Molly why are you lying?

Molly Why can’t you ask you ask for help?

Molly why can’t you accept that everything is not fine?

Molly? Molly?Ask! Ask! Please! Please!


[ Alight baby, mommy loves you.]

[ I love you too.]

[ Goodnight.]

[ goodBYE mom.]


It has been two hours since Molly got off the phone with her mom.

She sits on the kitchen counter.

She gets down and opens the medicine cabinet.

She grabs the sleeping pills her mother takes when she can’t sleep.

It is recommended to take one a day.

But Molly takes TWENTY sleeping pills.


(9:00 am) Monday morning.

Molly’s mom enters the house.

She walks in the kitchen and sees Molly laying down on the kitchen floor.

Molly!? Molly!?

Tear drops falling out of her eyes like a rainy April Morning onto Molly’s face.

Molly talk to me ,Molly talk to me please!

Molly wrote a note and left it on the ground right besides her.



[ Dear Mom,                                ]

       I love you, everything is fine. But I just have to leave you and reunite with daddy. I’ll see you in a few years when you come and join us. Once again everything is just fine.

                                     p.s. Don’t cry , it’s fine.]



(9:30am) Molly’s mom calls for help.

(10:00am) At the hospital Molly is dead.
“Here is a poem where a young girl says she is fine but she is not.”

— The End —